Adropin (34-76) (Human, Rat, Mouse) – Biotin Labeled

The Adropin (34-76) (Human, Rat, Mouse) – Biotin Labeled (Catalog #B-032-35) is a research reagent supplied by Phoenix Peptide under our specialized Biotin category. This item is offered at a regular price of $475 for a package size of 20 µg.

Biochemical & Structural Specifications

Amino Acid Sequence: CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP

Validation: Exhibits correct molecular weight

Storage, Handling & Operational Notes

Vial Contents: Each vial contains 20 µg of NET labeled peptide.

Related Research Products & Support

For complementary laboratory workflows, explore related items in our catalog: Urotensin II (Rat) – Biotin Labeled, Urotensin II (Mouse) – Biotin Labeled, and Urotensin II (Human) – Biotin Labeled available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.

Specification / Feature	Details
Catalog Number	B-032-35
Mass / Quantity	20 µg
Sequence	CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP
Contents	Each vial contains 20 µg of NET labeled peptide.
Category	Biotin
Price / Unit	$475
Validation	Exhibits correct molecular weight
Disulfide Bridge	Disulfide bridge(s): Cys34-Cys56