Apolipopprotein A-IV ( 55-121) / T55-121 (Mouse)

The Apolipopprotein A-IV ( 55-121) / T55-121 (Mouse) (Catalog #067-45) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $160 for a package size of 100ug.

Biochemical & Structural Specifications

Amino Acid Sequence: TQQLSTLFQDKLGDASTYADGVHNKLVPFVVQLSGHLAQETERVKE EIKKELEDLRDRMMPHANKVT

Molecular Weight: 7635.72 Da

Purity Level: ≥ 95%

Solubility: Soluble in water

Validation: Exhibits correct molecular weight

Storage, Handling & Operational Notes

Vial Contents: Each vial contains 100 µg of NET peptide.

Storage Guidelines: Store in dry form at 0-5°C.

Related Research Products & Support

For complementary laboratory workflows, explore related items in our catalog: ELA, N-terminal / prepro-ELA (23-41) (Human), ELA, N-terminal / prepro-ELA (23-39) (Human), and ELA-32 (Human) available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.

Specification / Feature	Details
Catalog Number	067-45
Mass / Quantity	100ug
Sequence	TQQLSTLFQDKLGDASTYADGVHNKLVPFVVQLSGHLAQETERVKE EIKKELEDLRDRMMPHANKVT
Molecular Weight	7635.72
Purity	≥ 95%
Storage	Store in dry form at 0-5°C.
Solubility	Soluble in water
Contents	Each vial contains 100 µg of NET peptide.
Category	Peptides
Price / Unit	$160
Validation	Exhibits correct molecular weight