ASPN mimic peptide / Asporin (160–205), prepro (Human)

The ASPN mimic peptide / Asporin (160–205), prepro (Human) (Catalog #051-79) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $395 for a package size of 100μg.

Biochemical & Structural Specifications

Amino Acid Sequence: NQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSAN

Molecular Weight: 5242.14 Da

Purity Level: Purity ≥97%

Validation: Exhibits correct M.W.

Storage, Handling & Operational Notes

Vial Contents: Each vial contains 100 µg of NET peptide.

Storage Guidelines: Store in dry form at 0-5°C.

Related Research Products & Support

For complementary laboratory workflows, explore related items in our catalog: Endorphin, beta (Human), acetyl-Endorphin, beta (Human), and Endorphin, beta (Equine) available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.

Specification / Feature	Details
Catalog Number	051-79
Quantity	100μg
Sequence	NQLSEIPLNLPKSLAELRIHENKVKKIQKDTFKGMNALHVLEMSAN
Molecular Weight	5242.14
Purity	Purity ≥97%
Storage	Store in dry form at 0-5°C.
Appearance	White powder
Contents	Each vial contains 100 µg of NET peptide.
Category	Peptides
Price / Unit	$395
Validation	Exhibits correct M.W.