CXCL14(1-58) (Human)

The CXCL14(1-58) (Human) (Catalog #045-28) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $360 for a package size of 100μg.

Biochemical & Structural Specifications

Amino Acid Sequence: SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQST

Molecular Weight: 6817.09 Da

Purity Level: Purity ≥95%

Validation: Exhibits correct M.W.

Storage, Handling & Operational Notes

Vial Contents: Each vial contains 100 µg of NET peptide.

Storage Guidelines: Store in dry form at 0-5°C.

Related Research Products & Support

For complementary laboratory workflows, explore related items in our catalog: iDiLeu-d9, iDiLeu-d6, and iDiLeu-d3 available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.

Specification / Feature	Details
Catalog Number	045-28
Quantity	100μg
Sequence	SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQST
Molecular Weight	6817.09
Purity	Purity ≥95%
Storage	Store in dry form at 0-5°C.
Appearance	White powder
Contents	Each vial contains 100 µg of NET peptide.
Category	Peptides
Price / Unit	$360
Validation	Exhibits correct M.W.
Disulfide Bridge	Disulfide Bonds : Cys3-Cys29, Cys5-Cys50