Leptin, recombinant (Human) – FAM Labeled

The Leptin, recombinant (Human) – FAM Labeled (Catalog #FG-003-12A) is a research reagent supplied by Phoenix Peptide under our specialized Fluorescent category. This item is offered at a regular price of $475 for a package size of 1 nmol.

Biochemical & Structural Specifications

Amino Acid Sequence: n-FAM-(AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTISKMDGTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC)

Molecular Weight: ~ 18.5 kDa Da

Solubility: Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5).

Validation: Exhibits correct molecular weight

Storage, Handling & Operational Notes

Vial Contents: Each vial contains 1 nmol of NET labeled protein.

Storage Guidelines: Store at -20°C with desiccant.

Related Research Products & Support

For complementary laboratory workflows, explore related items in our catalog: Ac2-26 / Lipocortin-1 (2-26) / Annexin-1 (2-26) (Human) – FAM Labeled, Ac2-12 / Lipocortin 1 (2-12) / Annexin-1 (2-12) (Human) – Rhodamine Labeled, and Ac2-12 / Lipocortin 1 (2-12) / Annexin-1 (2-12) (Human) – FAM Labeled available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.

Specification / Feature	Details
Catalog Number	FG-003-12A
Quantity	1 nmol
Sequence	n-FAM-(AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTISKMDGTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC)
Molecular Weight	~ 18.5 kDa
Storage	Store at -20°C with desiccant.
Solubility	Soluble in 50mM sodium phosphate buffer (pH 8.5) or 10% DMSO in PBS buffer (pH 7.5).
Contents	Each vial contains 1 nmol of NET labeled protein.
Category	Fluorescent
Price / Unit	$475
Validation	Exhibits correct molecular weight