$335.00
- Mass / Quantity: 100 µg
- Catalog #: 037-76
- Form & Storage: Lyophilized powder | Store desiccated at -20°C
832 in stock
MP31 / Micropeptide-31 (Human)
The MP31 / Micropeptide-31 (Human) (Catalog #037-76) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $335 for a package size of 100 µg.
Related Research Products & Support
For complementary laboratory workflows, explore related items in our catalog: QRFP-15 (Human), QRFP-10 (Human), and QRFP Receptor AQ27 (401-433) / SP9155 (401-433) (Mouse) available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.
| Specification / Feature | Details |
|---|---|
| Catalog Number | 037-76 |
| Mass / Quantity | 100 µg |
| Category | Peptides |
| Price / Unit | $335 |
| Sequence: | MWRDSLCAAAGYALGAGTRLRSVLSSRKLQP |
| Molecular Weight: | 3335.93 |
| Purity: | ≥95% |
| Validation: | Exhibits correct molecular weight |
| Solubility: | Soluble in water |
| Storage: | Up to 6 months in lyophilized form at 0-5ºC. For best results, rehydrate just before use. Aliquot before freezing to avoid repeated freeze-thaw cycles. |
| Appearance: | White powder |
| Contents: | Each vial contains 100 μg of NET peptide. |
| Disulfide Bridge: | Peptide contains free Cysteine and tends to dimerize. |
Related products
$475.00
$59.00
Peptides
$217.00
$59.00