$395.00
- Quantity: 100μg
- Catalog #: 051-77
- Purity: Purity ≥97 %
- Molecular Weight: 5256.13 Da
- Form & Storage: Lyophilized powder | Store desiccated at -20°C
1021 in stock
ASPN mimic peptide / Asporin (155–200), prepro (Rat)
The ASPN mimic peptide / Asporin (155–200), prepro (Rat) (Catalog #051-77) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $395 for a package size of 100μg.
Biochemical & Structural Specifications
Amino Acid Sequence: NQLSEIPLNLPRSLAELRIHDNKVKKIQKDTFKGMNALHVLEMSAN
Molecular Weight: 5256.13 Da
Purity Level: Purity ≥97 %
Validation: Exhibits correct M.W.
Storage, Handling & Operational Notes
Vial Contents: Each vial contains 100 µg of NET peptide.
Storage Guidelines: Store in dry form at 0-5°C.
Related Research Products & Support
For complementary laboratory workflows, explore related items in our catalog: acetyl-Endorphin, beta (Human), Endorphin, beta (Equine), and acetyl-Endorphin, beta (Bovine, Ovine, Camel) available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.
| Specification / Feature | Details |
|---|---|
| Catalog Number | 051-77 |
| Quantity | 100μg |
| Sequence | NQLSEIPLNLPRSLAELRIHDNKVKKIQKDTFKGMNALHVLEMSAN |
| Molecular Weight | 5256.13 |
| Purity | Purity ≥97 % |
| Storage | Store in dry form at 0-5°C. |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide. |
| Category | Peptides |
| Price / Unit | $395 |
| Validation | Exhibits correct M.W. |
Related products