$450.00
- Mass / Quantity: 100 ug
- Catalog #: 067-47
- Purity: ≥ 95%
- Molecular Weight: 3753.17 Da
- Form & Storage: Lyophilized powder | Store desiccated at -20°C
1012 in stock
Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse)
The Apolipopprotein A-IV ( 122-153) (Human) / T55-121 (Mouse) (Catalog #067-47) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $450 for a package size of 100 ug.
Biochemical & Structural Specifications
Amino Acid Sequence: pGlu-KIGDNLRELQQRLEPYADQLRTQVSTQAEQL
Molecular Weight: 3753.17 Da
Purity Level: ≥ 95%
Solubility: Soluble in water
Validation: Exhibits correct molecular weight
Storage, Handling & Operational Notes
Vial Contents: Each vial contains 100 µg of NET peptide
Storage Guidelines: Store in dry form at 0-5°C.
Related Research Products & Support
For complementary laboratory workflows, explore related items in our catalog: [pGlu1]-ELA-32 (Human), ELA-21 / prepro-ELA (34-54) (Human), and ELA-21 (Rat) available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.
| Specification / Feature | Details |
|---|---|
| Catalog Number | 067-47 |
| Mass / Quantity | 100 ug |
| Sequence | pGlu-KIGDNLRELQQRLEPYADQLRTQVSTQAEQL |
| Molecular Weight | 3753.17 |
| Purity | ≥ 95% |
| Storage | Store in dry form at 0-5°C. |
| Solubility | Soluble in water |
| Appearance | White powder |
| Contents | Each vial contains 100 µg of NET peptide |
| Category | Peptides |
| Price / Unit | $450 |
| Validation | Exhibits correct molecular weight |
Related products
Peptides