Apolipopprotein A-IV ( 21-54) (human)

The Apolipopprotein A-IV ( 21-54) (human) (Catalog #067-41) is a research reagent supplied by Phoenix Peptide under our specialized Peptides category. This item is offered at a regular price of $250 for a package size of 100 ug.

Biochemical & Structural Specifications

Amino Acid Sequence: EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSEL

Molecular Weight: 3668.28 Da

Purity Level: ≥ 98%

Solubility: Soluble in water

Validation: Exhibits correct molecular weight

Storage, Handling & Operational Notes

Vial Contents: Each vial contains 100 µg of NET peptide.

Storage Guidelines: Store in dry form at 0-5°C.

Related Research Products & Support

For complementary laboratory workflows, explore related items in our catalog: ELA-32 (Human), [pGlu1]-ELA-32 (Human), and ELA-21 / prepro-ELA (34-54) (Human) available through Phoenix Peptide. Guaranteed for quality assurance and analytical precision.

Specification / Feature	Details
Catalog Number	067-41
Mass / Quantity	100 ug
Sequence	EVSADQVATVMWDYFSQLSNNAKEAVEHLQKSEL
Molecular Weight	3668.28
Purity	≥ 98%
Storage	Store in dry form at 0-5°C.
Solubility	Soluble in water
Appearance	White powder
Contents	Each vial contains 100 µg of NET peptide.
Category	Peptides
Price / Unit	$250
Validation	Exhibits correct molecular weight